PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.A02796.1.p
Common NameEUGRSUZ_A02796
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 242aa    MW: 27080.2 Da    PI: 7.8999
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.A02796.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.15.7e-151562148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W+++Ed++l ++++++G  +W++++   g+ R +k+c++rw +yl
  Eucgr.A02796.1.p 15 KGLWSPDEDQRLRNYIHKHGYSCWSSVPINAGLQRNGKSCRLRWINYL 62
                      678*******************************************97 PP

2Myb_DNA-binding59.19.8e-1968113148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T +E+e +++++++lG++ W+ Ia++++ gRt++++k++w++yl
  Eucgr.A02796.1.p  68 RGAFTVQEEETILNLHHLLGNK-WSQIAQHLP-GRTDNEIKNHWHSYL 113
                       89********************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.2751062IPR017930Myb domain
SuperFamilySSF466891.97E-2912109IPR009057Homeodomain-like
SMARTSM007171.2E-91464IPR001005SANT/Myb domain
PfamPF002497.8E-141562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-211669IPR009057Homeodomain-like
CDDcd001671.30E-91862No hitNo description
PROSITE profilePS5129428.12763117IPR017930Myb domain
SMARTSM007171.0E-1667115IPR001005SANT/Myb domain
PfamPF002492.6E-1768113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2670117IPR009057Homeodomain-like
CDDcd001675.17E-1270113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MGCKSVEKPK ARHRKGLWSP DEDQRLRNYI HKHGYSCWSS VPINAGLQRN GKSCRLRWIN  60
YLRPGLKRGA FTVQEEETIL NLHHLLGNKW SQIAQHLPGR TDNEIKNHWH SYLKKKINIK  120
ADESHLQMPS NSDSVGSPNS TDFPSDHTQS SDTTEYTKSS ASQIPKIFNP TKEGESSLPT  180
LLFEEWLSLD NSPGGSFTNH AESQDQISGN GLVQCLSGDD LCILSKSGCS PEEVISREIL  240
K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-25151187109B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.A02796.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010061134.11e-157PREDICTED: transcription factor LAF1-like
SwissprotQ9M0K44e-57LAF1_ARATH; Transcription factor LAF1
TrEMBLA0A059DJX61e-180A0A059DJX6_EUCGR; Uncharacterized protein
STRINGPGSC0003DMT4000370805e-78(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.16e-63myb domain protein 19